PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001879-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 313aa    MW: 34955.9 Da    PI: 6.0939
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001879-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEde+l+ +++++G  +W+  ++  g++R++k+c++rw +yl
    NNU_001879-RA 14 KGPWAPEEDEKLLLYIQKHGHSNWRFLPKLAGLNRCGKSCRLRWENYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.61.8e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+e +++++  lG++ W+  a++++ gRt++++k++w++
    NNU_001879-RA  67 RGKFSPEEEETILNLHFVLGNK-WSVMAKHLP-GRTDNEIKNFWNT 110
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.429961IPR017930Myb domain
SuperFamilySSF466893.44E-3011108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-141461IPR001005SANT/Myb domain
CDDcd001673.16E-101661No hitNo description
PROSITE profilePS5129422.79262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565117IPR009057Homeodomain-like
SMARTSM007171.9E-1466114IPR001005SANT/Myb domain
PfamPF002495.1E-1467110IPR001005SANT/Myb domain
CDDcd001671.96E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRSPCCDQS GLKKGPWAPE EDEKLLLYIQ KHGHSNWRFL PKLAGLNRCG KSCRLRWENY  60
LKPDIKRGKF SPEEEETILN LHFVLGNKWS VMAKHLPGRT DNEIKNFWNT RIKRKLIKMG  120
FDPMTHQPRT DLFSSLSQLL LIPLATPAEA CHQLAKLIGC LPQMILMNST SPIKENPVLS  180
SFEWENPSPN PLGMATSQPV LPVPDSTLFS YSSDLQLPGS IQTPLTNEIT QASDVTSFSQ  240
EESWLQSPWV PSAASPTHPP HQPPAPAAPL VTETTMTSNT TGDACSSSSY EGEASLFWPE  300
LFLDDDSFFP LLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274085.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A068TZV31e-101A0A068TZV3_COFCA; Uncharacterized protein
STRINGVIT_07s0141g00100.t011e-100(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.13e-85myb domain protein 92